You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324854 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GRSF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRSF1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 53kDa |
Target | GRSF1 |
UniProt ID | Q12849 |
Protein Sequence | Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
NCBI | NP_002083 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ13125 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Jurkat tissue using GRSF1 antibody
Western blot analysis of human Hela tissue using GRSF1 antibody
Western blot analysis of human Fetal Brain tissue using GRSF1 antibody
Western blot analysis of human Fetal Liver tissue using GRSF1 antibody
Western blot analysis of human Fetal Lung tissue using GRSF1 antibody
Western blot analysis of human Jurkat tissue using GRSF1 antibody
Western blot analysis of human Fetal Liver tissue using GRSF1 antibody
Western blot analysis of human Hela tissue using GRSF1 antibody
Western blot analysis of Hela cell lysate tissue using GRSF1 antibody
Western blot analysis of human Fetal Brain tissue using GRSF1 antibody
Western blot analysis of human Fetal Heart tissue using GRSF1 antibody
Filter by Rating