You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324854 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GRSF1 |
Target | GRSF1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRSF1 |
Protein Sequence | Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
UniProt ID | Q12849 |
MW | 53kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti FLJ13125 antibody |
Note | For research use only |
NCBI | NP_002083 |
GRSF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb324854 with 1:200 dilution. Western blot was performed using orb324854 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: GRSF1 IP with orb324854 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.
Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.
Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |