GRM6 Rabbit Polyclonal Antibody

• Catalog Number: orb574284
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRM6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GRM6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95kDa
• Target: GRM6
• UniProt ID: O15303
• Protein Sequence: Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL
• NCBI: NP_000834
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: mGlu6, CSNB1B, GPRC1F, MGLUR6
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Lanes: Lane 1: 10 ug WT mouse retina lysate, Lane 2: 10 ug GRM6 knockout mouse retina lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRM6.

WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.