Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRK5 Rabbit Polyclonal Antibody

SKU: orb582463

Description

Rabbit polyclonal antibody to GRK5

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRK5
TargetGRK5
Protein SequenceSynthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
Molecular Weight68kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GPRK5, FP2025

Similar Products

  • GRK5 Antibody (C-term) [orb1929652]

    IHC-P,  WB

    Bovine

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GRK5 Rabbit Polyclonal Antibody [orb316571]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GRK5 Rabbit Polyclonal Antibody [orb100004]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • GRK5 Antibody [orb675598]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GRK5 Antibody [orb1311915]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRK5 Rabbit Polyclonal Antibody

GRK5 antibody - middle region (orb582463), Catalog Number: orb582463, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of alveolar macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GRK5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

GRK5 Rabbit Polyclonal Antibody

Lanes: Lane 1: 1 ug human GRK5 protein, Lane 2: 0.25 ug human GRK5 protein, Lane 3: 0.1 ug human GRK5 protein, Lane 4: 5 ug rat striatum homogenate, Lane 5: 5 ug rat striatum cytosol, Lane 6: 5 ug rat striatum light membrane fraction, Lane 7: 5 ug rat striatum synaptic membrane fraction, Lane 8: 5 ug rat striatum crude synaptic vesicle fraction, Lane 9: 5 ug rat striatum homogenate, Lane 10: 5 ug rat striatum cytosol, Lane 11: 5 ug rat striatum light membrane fraction, Lane 12: 5 ug rat striatum synaptic membrane fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:15000, Gene Name: GRK5.

GRK5 Rabbit Polyclonal Antibody

Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRK5.

GRK5 Rabbit Polyclonal Antibody

Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: GRK5.

GRK5 Rabbit Polyclonal Antibody

WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005299

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GRK5 Rabbit Polyclonal Antibody (orb582463)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry