You have no items in your shopping cart.
GRK5 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRK5 |
| Target | GRK5 |
| Protein Sequence | Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
| Molecular Weight | 68kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GRK5 Rabbit Polyclonal Antibody [orb316571]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgGRK5 Rabbit Polyclonal Antibody [orb214003]
IHC, WB
Bovine, Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 30 μl, 50 μlGRK5 Rabbit Polyclonal Antibody [orb100004]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Mouse, Porcine
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRK5 antibody - middle region (orb582463), Catalog Number: orb582463, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of alveolar macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 1 ug human GRK5 protein, Lane 2: 0.25 ug human GRK5 protein, Lane 3: 0.1 ug human GRK5 protein, Lane 4: 5 ug rat striatum homogenate, Lane 5: 5 ug rat striatum cytosol, Lane 6: 5 ug rat striatum light membrane fraction, Lane 7: 5 ug rat striatum synaptic membrane fraction, Lane 8: 5 ug rat striatum crude synaptic vesicle fraction, Lane 9: 5 ug rat striatum homogenate, Lane 10: 5 ug rat striatum cytosol, Lane 11: 5 ug rat striatum light membrane fraction, Lane 12: 5 ug rat striatum synaptic membrane fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:15000, Gene Name: GRK5.

Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRK5.

Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: GRK5.

WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.
Documents Download
Request a Document
Protocol Information
GRK5 Rabbit Polyclonal Antibody (orb582463)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










