Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRK5 Rabbit Polyclonal Antibody

SKU: orb582463

Description

GRK5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GRK5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GRK5. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GRK5
TargetGRK5
Protein SequenceSynthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
Molecular Weight68kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GPRK5, FP2025

Similar Products

  • GRK5 Antibody (C-term) [orb1929652]

    IHC-P,  WB

    Bovine

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GRK5 Rabbit Polyclonal Antibody [orb316571]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GRK5 Rabbit Polyclonal Antibody [orb100004]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GRK5 Antibody [orb675598]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • GRK5 Antibody [orb1311915]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRK5 Rabbit Polyclonal Antibody

GRK5 antibody - middle region (orb582463), Catalog Number: orb582463, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of alveolar macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GRK5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

GRK5 Rabbit Polyclonal Antibody

Lanes: Lane 1: 1 ug human GRK5 protein, Lane 2: 0.25 ug human GRK5 protein, Lane 3: 0.1 ug human GRK5 protein, Lane 4: 5 ug rat striatum homogenate, Lane 5: 5 ug rat striatum cytosol, Lane 6: 5 ug rat striatum light membrane fraction, Lane 7: 5 ug rat striatum synaptic membrane fraction, Lane 8: 5 ug rat striatum crude synaptic vesicle fraction, Lane 9: 5 ug rat striatum homogenate, Lane 10: 5 ug rat striatum cytosol, Lane 11: 5 ug rat striatum light membrane fraction, Lane 12: 5 ug rat striatum synaptic membrane fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:15000, Gene Name: GRK5.

GRK5 Rabbit Polyclonal Antibody

Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRK5.

GRK5 Rabbit Polyclonal Antibody

Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: GRK5.

GRK5 Rabbit Polyclonal Antibody

WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005299

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GRK5 Rabbit Polyclonal Antibody (orb582463)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry