GRIN2A Rabbit Polyclonal Antibody

• Catalog Number: orb575348
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRIN2A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRIN2A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 163kDa
• Target: GRIN2A
• UniProt ID: Q12879
• Protein Sequence: Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
• NCBI: NP_000824
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LKS, EPND, FESD, NR2A, GluN2A, NMDAR2A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Rat Hippocampal Neurons - 14DIV, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-Cy3, Secondary Antibody dilution: 1:500, Color/Signal Descriptions: Green: GFP Red: NR2a Yellow: VGLUT12, Gene Name: GRIN2A.

WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.