You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577218 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GRHL2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRHL2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 71 kDa |
Target | GRHL2 |
UniProt ID | Q6ISB3 |
Protein Sequence | Synthetic peptide located within the following region: VEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLME |
NCBI | NP_079191 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BOM, ECTDS, PPCD4, DFNA28, TFCP2L3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
Rabbit Anti-GRHL2 Antibody, Paraffin Embedded Tissue: Human Brain, Antibody Concentration: 5 ug/ml.
WB Suggested Anti-GRHL2 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |