You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575231 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GREB1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GREB1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 43kDa |
Target | GREB1 |
UniProt ID | Q4ZG55 |
Protein Sequence | Synthetic peptide located within the following region: DNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYL |
NCBI | NP_683701 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | KIAA0575 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 293T, Antibody dilution: 1.0 ug/ml.
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.
Rabbit Anti-GREB1 Antibody, Catalog Number: orb575231, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GREB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that GREB1 is expressed in MCF7.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |