GREB1 Rabbit Polyclonal Antibody

• Catalog Number: orb575231
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GREB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GREB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: GREB1
• UniProt ID: Q4ZG55
• Protein Sequence: Synthetic peptide located within the following region: DNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYL
• NCBI: NP_683701
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: KIAA0575
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Rabbit Anti-GREB1 Antibody, Catalog Number: orb575231, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GREB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that GREB1 is expressed in MCF7.