Cart summary

You have no items in your shopping cart.

GRAMD1B Rabbit Polyclonal Antibody (FITC)

GRAMD1B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088270

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088270
CategoryAntibodies
DescriptionGRAMD1B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human GRAMD1B
Protein SequenceSynthetic peptide located within the following region: SDHSSDKSPSTPEQGVQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRN
UniProt IDQ3KR37
MW81kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesLINC01059
NoteFor research use only
NCBINP_065767