GPRIN2 Rabbit Polyclonal Antibody

• Catalog Number: orb586685
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPRIN2
• Target: GPRIN2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRIN2
• Protein Sequence: Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE
• UniProt ID: O60269
• MW: 51kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GRIN2, KIAA0514
• Note: For research use only
• NCBI: NP_055511

Sample Type: MDA-MB-435S Whole cell lysates, Antibody dilution: 1.0 ug/ml.