You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331279 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPRC6A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 103kDa |
Target | GPRC6A |
UniProt ID | Q5T6X5 |
Protein Sequence | Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE |
NCBI | NP_683766 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti GPCR antibody, anti bA86F4.3 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human HCT15 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-GPRC6A Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |