GPRC6A Rabbit Polyclonal Antibody

SKU: orb331279

Description

Rabbit polyclonal antibody to GPRC6A

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A
• Target: GPRC6A
• Protein Sequence: Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
• Molecular Weight: 103kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti GPCR antibody, anti bA86F4.3 antibody

Sample Tissue: Human HCT15 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-GPRC6A Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell.

Quick Database Links

Gene Symbol

GPRC6A

UniProt

Q5T6X5

RefSeq (Protein):NP_683766