You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586315 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPR84 |
Target | GPR84 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Porcine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR84 |
Protein Sequence | Synthetic peptide located within the following region: ATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSS |
UniProt ID | Q9NQS5 |
MW | 44kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | EX33, GPCR4 |
Note | For research use only |
NCBI | NP_065103 |
WB Suggested Anti-GPR84 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.
FC, IF, IHC-Fr, IHC-P | |
Bovine, Porcine | |
Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Monkey, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF | |
Bovine, Porcine | |
Human, Mouse, Rabbit | |
Rabbit | |
Polyclonal | |
FITC |