Cart summary

You have no items in your shopping cart.

GPR141 Rabbit Polyclonal Antibody (FITC)

GPR141 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088282

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088282
CategoryAntibodies
DescriptionGPR141 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human GPR141
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW35kDa
UniProt IDQ7Z602
Protein SequenceSynthetic peptide located within the following region: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK
NCBINP_861456
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPGR13
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.