GPM6A Rabbit Polyclonal Antibody

• Catalog Number: orb586134
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPM6A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Reactivity: Human, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: GPM6A
• UniProt ID: P51674
• Protein Sequence: Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN
• NCBI: NP_005268
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: M6A, GPM6
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Antibody dilution: 1.0 ug/ml, Sample Type: Human brain.

Sample Tissue: Human Brain, Antibody dilution: 1 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.

Lanes: Lane 1: 250 ug rat hippocampal culture neurons, Lane 2: 200 ug rat hippocampal culture neurons, Lane 3: 100 ug rat hippocampal culture neurons, Lane 4: 50 ug rat hippocampal culture neurons, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.

Lanes: Lane 1: 400 ug rat hippocampal, Lane 2: 300 ug rat hippocampal, Lane 3: 200 ug rat hippocampal, Lane 4: 100 ug rat hippocampal, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.

Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.

Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.