You have no items in your shopping cart.
GPM6A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | GPM6A |
| Protein Sequence | Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN |
| Molecular Weight | 31kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GPM6A Rabbit Polyclonal Antibody [orb183993]
FC, IF, IHC-Fr, IHC-P, WB
Canine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlGPM6A Rabbit Polyclonal Antibody [orb627456]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Antibody dilution: 1.0 ug/ml, Sample Type: Human brain.

Sample Tissue: Human Brain, Antibody dilution: 1 ug/ml.

Positive control (+): Human Liver (LI), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.

Lanes: Lane 1: 250 ug rat hippocampal culture neurons, Lane 2: 200 ug rat hippocampal culture neurons, Lane 3: 100 ug rat hippocampal culture neurons, Lane 4: 50 ug rat hippocampal culture neurons, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.

Lanes: Lane 1: 400 ug rat hippocampal, Lane 2: 300 ug rat hippocampal, Lane 3: 200 ug rat hippocampal, Lane 4: 100 ug rat hippocampal, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.

Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.

Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.
Documents Download
Request a Document
Protocol Information
GPM6A Rabbit Polyclonal Antibody (orb586134)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







