GPBAR1 Rabbit Polyclonal Antibody

• Catalog Number: orb585885
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPBAR1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: GPBAR1
• UniProt ID: Q8TDU6
• Protein Sequence: Synthetic peptide located within the following region: AAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQ
• NCBI: NP_733800
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BG37, TGR5, M-BAR, GPCR19, GPR131
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-GPBAR1 Antibody, Titration: 1.0 ug/ml, Positive Control: MCF7 Whole Cell.