You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581343 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GP1BA |
| Target | GP1BA |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA |
| Protein Sequence | Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS |
| UniProt ID | P07359 |
| MW | 72 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBP Read more... |
| Research Area | Cell Biology, Molecular Biology, Signal Transducti Read more... |
| Note | For research use only |
| NCBI | NP_000164 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GP1BA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rat | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review