GP1BA Rabbit Polyclonal Antibody

• Catalog Number: orb581343
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GP1BA
• Target: GP1BA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
• Protein Sequence: Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
• UniProt ID: P07359
• MW: 72 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBP
• Note: For research use only
• NCBI: NP_000164

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.

WB Suggested Anti-GP1BA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.