You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1 |
| Target | GOT1 |
| Protein Sequence | Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
| Molecular Weight | 46kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Aspartate Aminotransferase/GOT1 Rabbit Polyclonal Antibody [orb745949]
ELISA, FC, ICC, IF, IHC, KO/KD Validated, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgGOT1 Antibody (C-term) [orb1431245]
FC, IHC-P, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μlGOT1 Rabbit Polyclonal Antibody [orb330539]
WB
Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlGOT1 Rabbit Polyclonal Antibody [orb213988]
IF, IH, KO/KD Validated, WB
Bovine, Human, Monkey, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: NCI-H226, Antibody dilution: 1.0 ug/ml. GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226.

Rabbit Anti-GOT1 Antibody, Catalog Number: orb330538, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GOT1 Antibody, Titration: 1 ug/ml, Positive Control: NCI-H226 Whole Cell, GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226.
Documents Download
Request a Document
Protocol Information
GOT1 Rabbit Polyclonal Antibody (orb330538)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review















