GOT1 antibody

• Catalog Number: orb330538
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GOT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Equine, Goat, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: GOT1
• UniProt ID: P17174
• Protein Sequence: Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
• NCBI: NP_002070
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti GIG18 antibody, anti ASTQTL1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of NCI-H226 Whole Cell tissue using GOT1 antibody

Immunohistochemical staining of human Pineal tissue using GOT1 antibody

Western blot analysis of human Fetal Liver tissue using GOT1 antibody

Western blot analysis of human NCI-H226 tissue using GOT1 antibody