You have no items in your shopping cart.
Cart summary
Item 1 of 1
GNLY Rabbit Polyclonal Antibody
Catalog Number: orb578448
| Catalog Number | orb578448 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GNLY |
| Target | GNLY |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the n terminal region of human GNLY |
| Protein Sequence | Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG |
| UniProt ID | B4DJJ4 |
| MW | 11kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LAG2, NKG5, LAG-2, D2S69E, TLA519 |
| Note | For research use only |
| NCBI | EAW99485 |
WB Suggested Anti-GNLY Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.
- Item 1 of 1
GNLY Rabbit Polyclonal Antibody [orb13434]
IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
