GNL3L Rabbit Polyclonal Antibody

• Catalog Number: orb584120
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNL3L
• Target: GNL3L
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
• Protein Sequence: Synthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
• UniProt ID: Q9NVN8
• MW: 66 kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GNL3B
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_061940

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The isoforms of 66 kDa and 57 kDa are identified in a subset of these samples.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is contained within a 66 kDa isoform as well as a 57 kDa isoform. Protein may be sumoylated.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: HeLa, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: GNL3L.

WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.