You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584160 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAI3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GNAI3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41 kDa |
Target | GNAI3 |
UniProt ID | P08754 |
Protein Sequence | Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY |
NCBI | NP_006487 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | 87U6, ARCND1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-GNAI3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |