GNAI2 Rabbit Polyclonal Antibody

• Catalog Number: orb582416
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAI2
• Target: GNAI2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2
• Protein Sequence: Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
• UniProt ID: P04899
• MW: 40kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_002061

Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-GNAI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.