You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb582416 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GNAI2 |
| Target | GNAI2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2 |
| Protein Sequence | Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA |
| UniProt ID | P04899 |
| MW | 40kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1 |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| NCBI | NP_002061 |

Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-GNAI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
ELISA, IHC, WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Rabbit | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review