You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586117 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNA11 |
Target | GNA11 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES |
UniProt ID | P43444 |
MW | 42 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FBH, FBH2, FHH2, HHC2, GNA-11, HYPOC2 |
Note | For research use only |
NCBI | NP_002058 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HEK293T.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in 721_B.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HeLa.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-GNA11 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |