GNA11 Rabbit Polyclonal Antibody

• Catalog Number: orb586117
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNA11
• Target: GNA11
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES
• UniProt ID: P43444
• MW: 42 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FBH, FBH2, FHH2, HHC2, GNA-11, HYPOC2
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_002058

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HEK293T.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in 721_B.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HeLa.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-GNA11 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.