You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | GNA11 |
| Protein Sequence | Synthetic peptide located within the following region: PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES |
| Molecular Weight | 42 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GNA11 rabbit pAb Antibody [orb772578]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlGNA11 Rabbit Polyclonal Antibody [orb586118]
WB
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlGNA11 Rabbit Polyclonal Antibody [orb2955287]
ELISA, IHC, WB
Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgGNA11 Rabbit Polyclonal Antibody [orb378076]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HEK293T.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in 721_B.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GNA11 is expressed in HeLa.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Kidney, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-GNA11 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.
Documents Download
Request a Document
GNA11 Rabbit Polyclonal Antibody (orb586117)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






