GLYATL3 antibody

• Catalog Number: orb325457
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLYATL3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLYATL3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: GLYATL3
• UniProt ID: Q5SZD4
• Protein Sequence: Synthetic peptide located within the following region: WSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDD
• NCBI: NP_001010904
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti C6orf140 antibody, anti bA28H17.2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Brain tissue using GLYATL3 antibody