GLRX5 Rabbit Polyclonal Antibody

• Catalog Number: orb583364
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GLRX5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16kDa
• Target: GLRX5
• UniProt ID: Q86SX6
• Protein Sequence: Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
• NCBI: NP_057501
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GRX5, PRSA, SIDBA3, SPAHGC, FLB4739, PR01238, PRO1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 5 ug/ml.

WB Suggested Anti-GLRX5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.