Cart summary

You have no items in your shopping cart.

Glra3 Rabbit Polyclonal Antibody (FITC)

Glra3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2133961

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2133961
CategoryAntibodies
DescriptionGlra3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW56kDa
UniProt IDQ91XP5
Protein SequenceSynthetic peptide located within the following region: SLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIR
NCBINP_536686
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.