GLP-1 (9-36) amide

• Catalog Number: orb1147100
• Category: Proteins
• Description: Major metabolite of glucagon like peptide GLP-1 (7-36) amide; Peptides.
• CAS Number: 161748-29-4
• Modifications: C terminal amide.
• Structure: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
• Target Areas: Glucagon and related receptors
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 3089.4 Da
• Formula: C₁₄₀H₂₁₄N₃₆O₄₃
• Solubility (25°C): Soluble in dilute acid
• Protein Sequence: H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
• Storage: Store dry, frozen and desiccated
• Alternative names: 161748-29-4, EGTFTSDVSSYLEGQAAKEFIAWLVKGRGH040, GL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.