GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)

• Catalog Number: orb2694527
• Category: Proteins
• Description: GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor.
• CAS Number: 161748-29-4
• Purity: ≥95%
• MW: 3089.48
• Formula: C₁₄₀H₂₁₄N₃₆O₄₃
• Target: GCCR
• Solubility (25°C): Water: ≥ 25 mg/mL
• Protein Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
• Note: For research use only
• Expiration Date: 6 months from date of receipt.