GJC2 Rabbit Polyclonal Antibody

• Catalog Number: orb576036
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GJC2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJC2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: GJC2
• UniProt ID: Q5T442
• Protein Sequence: Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
• NCBI: NP_065168
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Cx47, HLD2, GJA12, SPG44, CX46.6, LMPH1C, LMPHM3,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-GJC2 Antibody, Catalog Number: orb576036, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, some cytoplasm, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GJC2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

WB Suggested Anti-GJC2 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-GJC2 antibody Titration: 1 ug/ml, Sample Type: Human liver.