Gjb3 Rabbit Polyclonal Antibody

• Catalog Number: orb578613
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gjb3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: Gjb3
• UniProt ID: P28231
• Protein Sequence: Synthetic peptide located within the following region: MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
• NCBI: NP_032152
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Cnx3, Cx31, Cxnc, Cnx31, Gjb-3, D4Wsu144, D4Wsu144
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Gjb3 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate.