GJB2 Rabbit Polyclonal Antibody

• Catalog Number: orb576030
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GJB2
• Target: GJB2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2
• Protein Sequence: Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
• UniProt ID: P29033
• MW: 25kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HID, KID, PPK, BAPS, CX26, DFNA3, DFNB1, NSRD1, DF
• Note: For research use only
• NCBI: NP_003995

WB Suggested Anti-GJB2 Antibody, Positive Control: Lane 1: 4 ug mCx26 elution fraction 6, Lane 2: 4 ug mCx26 elution fraction 7, Lane 3: 4 ug mCx26 elution fraction 6 + other Cx26 antibody, Lane 4: 4 ug mCx26 elution fraction 7 + other Cx26 antibody, Primary Antibody Dilution: 1:3000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:3000.

WB Suggested Anti-GJB2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.