You have no items in your shopping cart.
GJA4 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GJA4 |
| Target | GJA4 |
| Protein Sequence | Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
| Molecular Weight | 37 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Connexin 37 rabbit pAb Antibody [orb768403]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlGJA4 Rabbit Polyclonal Antibody [orb1939840]
ELISA, FC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgGja4 Rabbit Polyclonal Antibody [orb578611]
WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlConnexin-37 Rabbit Polyclonal Antibody [orb6190]
WB
Bovine, Equine, Guinea pig, Porcine, Rabbit, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-GJA4 Antibody, Catalog Number: orb576029, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells and macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. GJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Documents Download
Request a Document
Protocol Information
GJA4 Rabbit Polyclonal Antibody (orb576029)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





