GJA4 Rabbit Polyclonal Antibody

SKU: orb576029

Description

Rabbit polyclonal antibody to GJA4

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJA4
• Target: GJA4
• Protein Sequence: Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
• Molecular Weight: 37 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CX37

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-GJA4 Antibody, Catalog Number: orb576029, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells and macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. GJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

GJA4

UniProt

P35212

RefSeq (Protein):NP_002051