GJA4 Rabbit Polyclonal Antibody

• Catalog Number: orb576029
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GJA4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GJA4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37 kDa
• Target: GJA4
• UniProt ID: P35212
• Protein Sequence: Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
• NCBI: NP_002051
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CX37
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-GJA4 Antibody, Catalog Number: orb576029, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells and macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GJA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. GJA4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.