You have no items in your shopping cart.
Cart summary
Item 1 of 1
GIGYF2 Rabbit Polyclonal Antibody
Catalog Number: orb326501
| Catalog Number | orb326501 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GIGYF2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human GIGYF2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 150kDa |
| Target | GIGYF2 |
| UniProt ID | Q6Y7W6 |
| Protein Sequence | Synthetic peptide located within the following region: DDPGRPNFEEGGPTSVGRKHEFIRSESENWRIFREEQNGEDEDGGWRLAG |
| NCBI | NP_001096616.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | GYF2, PERQ2, PERQ3, PARK11, TNRC15 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: COLO205 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
Anti-GIGYF2 Antibody [orb411905]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
