You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585737 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GGH |
Target | GGH |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: DGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYT |
UniProt ID | Q92820 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GH |
Note | For research use only |
NCBI | NP_003869 |
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-GGH Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Kidney.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |