You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587018 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GFRAL |
Target | GFRAL |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GFRAL |
Protein Sequence | Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA |
UniProt ID | Q6UXV0 |
MW | 45 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | GRAL, UNQ9356, C6orf144, bA360D14.1 |
Note | For research use only |
NCBI | NP_997293 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 38 kDa and the protein may be modified by glycosylation.
Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.
Sample Type: Hela Whole cell lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Equine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |