GFRAL Rabbit Polyclonal Antibody

• Catalog Number: orb587018
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GFRAL
• Target: GFRAL
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GFRAL
• Protein Sequence: Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
• UniProt ID: Q6UXV0
• MW: 45 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GRAL, UNQ9356, C6orf144, bA360D14.1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_997293
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 38 kDa and the protein may be modified by glycosylation.

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Hela Whole cell lysates, Antibody dilution: 1.0 ug/ml.