Cart summary

You have no items in your shopping cart.

GFOD1 Rabbit Polyclonal Antibody (FITC)

GFOD1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2101863

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2101863
CategoryAntibodies
DescriptionGFOD1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GFOD1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW43kDa
UniProt IDQ9NXC2
Protein SequenceSynthetic peptide located within the following region: NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT
NCBINP_061861
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesADG-90, C6orf114
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.