Gfap Rabbit Polyclonal Antibody

• Catalog Number: orb582411
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gfap
• Target: Gfap
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL
• UniProt ID: P03995
• MW: 46kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AI836096
• Research Area: Neuroscience, Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_034407
• Expiration Date: 12 months from date of receipt.

Sample Type: human optic nerve head (frozen), Blue: DAPI, Red: Gfap, Primary dilution: 1:250.

Gfap antibody - N-terminal region (orb582411) validated by WB using Mouse Thymus at 1 ug/ml.

Rabbit Anti-GFAP Antibody, Catalog Number: orb582411, Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.