GDI1 Rabbit Polyclonal Antibody

• Catalog Number: orb592809
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GDI1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Guinea pig, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GDI1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: GDI1
• UniProt ID: P31150
• Protein Sequence: Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
• NCBI: NP_001484
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 1A, GDIL, MRX41, MRX48, OPHN2, XAP-4, RABGD1A, RAB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Human, Mouse

WB Suggested Anti-GDI1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.