You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592809 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GDI1 |
Target | GDI1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Equine, Guinea pig, Rabbit, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GDI1 |
Protein Sequence | Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ |
UniProt ID | P31150 |
MW | 51kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | 1A, GDIL, MRX41, MRX48, OPHN2, XAP-4, RABGD1A, RAB Read more... |
Note | For research use only |
NCBI | NP_001484 |
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.
Human, Mouse
WB Suggested Anti-GDI1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
WB | |
Human, Mouse, Primate, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |