You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb699737 |
---|---|
Category | Antibodies |
Description | GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | GDF9/4261 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | Mouse IgG1 |
Immunogen | Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG. |
Antibody Type | Primary Antibody |
Dilution range | ELISA: order Ab without BSA for coating,Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml for 30 minutes at RT |
Purity | Protein G affinity chromatography |
Conjugation | Unconjugated |
Formula | 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced), 0.05% sodium azide |
Hazard Information | This GDF9 antibody is available for research use only. |
UniProt ID | O60383 |
Storage | Store the GDF9 antibody at 2-8°C (with azide) or aliquot and store at -20°C or colder (without azide). |
Buffer/Preservatives | 0.2 mg/ml in 1X PBS with 0.1 mg/ml rAlbumin (US sourced), 0.05% sodium azide |
Note | For research use only |
Application notes | Optimal dilution of the GDF9 antibody should be determined by the researcher. |
Expiration Date | 12 months from date of receipt. |
IHC staining of FFPE human ovary with GDF9 antibody. HIER: boil tissue sections in pH9 10mM Tris with 1mM EDTA for 20 min and allow to cool before testing.
SDS-PAGE analysis of purified, BSA-free GDF9 antibody as confirmation of integrity and purity.
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IHC-P | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, WB | |
Human | |
Rat | |
Monoclonal | |
Unconjugated |