GDF9 (Growth Differentiation Factor 9) Antibody

• Catalog Number: orb750802
• Category: Antibodies
• Description: Mouse monoclonal antibody to GDF9
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: GDF9/4261
• Tested applications: ELISA, IHC, WB
• Reactivity: Human
• Isotype: IgG1
• Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
• Concentration: 200 μg/ml
• Dilution range: ELISA (For coating, order antibody without BSA); Western Blot (1-2ug/ml); ,Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT),(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95 °C followed by cooling at RT for 20 minutes),Optimal dilution for a specific application should be determined.
• Form/Appearance: 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml.
• Purity: Purified from Bioreactor Concentrate by Protein A/G.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: GDF9
• Entrez: 2661
• UniProt ID: O60383
• Expression System: Bioreactor
• Storage: Antibody with azide - store at 2 to 8 °C
• Buffer/Preservatives: Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide
• Alternative names: Anti-Growth/differentiation factor 9 antibody, ant
• Note: For research use only
• Application notes: Positive Control: Human ovary
• Expiration Date: 12 months from date of receipt.

SDS-PAGE Analysis Purified GDF9 Mouse Monoclonal Antibody (GDF9/4261)

Formalin-fixed, paraffin-embedded human ovary stained with GDF9 Mouse Monoclonal Antibody (GDF9/4261)