GDF9 Antibody

SKU: orb750802

Description

Mouse monoclonal antibody to GDF9

Research Area

Signal Transduction

Images & Validation

• Tested Applications: ELISA, IHC, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone No.: GDF9/4261
• Immunogen: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
• Target: GDF9
• Source/Expression System: Bioreactor
• Molecular Weight: 51 kDa
• Purity: Purified from Bioreactor Concentrate by Protein A/G.
• Purification: Protein G
• Conjugation: Unconjugated

Storage & Handling

• Storage: Antibody with azide - store at 2 to 8 °C
• Form/Appearance: 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide. Also available WITHOUT rAlbumin & azide at 1.0mg/ml.
• Buffer/Preservatives: Prepared in 10mM PBS with 0.05% rAlbumin & 0.05% azide
• Concentration: 200 μg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Anti-Growth/differentiation factor 9 antibody, anti-GDF-9 antibody, anti-GDF9 antibody

SDS-PAGE Analysis Purified GDF9 Mouse Monoclonal Antibody (GDF9/4261)

Formalin-fixed, paraffin-embedded human ovary stained with GDF9 Mouse Monoclonal Antibody (GDF9/4261)

Quick Database Links

Gene Symbol

GDF9

UniProt

O60383