GDF5 Rabbit Polyclonal Antibody

• Catalog Number: orb585603
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GDF5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of GDF5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: GDF5
• UniProt ID: P43026
• Protein Sequence: Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
• NCBI: NP_000548
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OS5, LAP4, BDA1C, BMP14, CDMP1, LAP-4, SYM1B, SYNS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-GDF5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GDF5 Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.