GCM1 Rabbit Polyclonal Antibody

• Catalog Number: orb329549
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GCM1
• Target: GCM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
• Protein Sequence: Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
• UniProt ID: Q9NP62
• MW: 49 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti GCMA antibody, anti hGCMa antibody
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_003634

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 0.5 ug/mL.

Human 293T

Human Lung

Human Spleen

WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:7812500, Positive Control: Human Placenta.