You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329549 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GCM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Canine, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 49 kDa |
Target | GCM1 |
UniProt ID | Q9NP62 |
Protein Sequence | Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK |
NCBI | NP_003634 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti GCMA antibody, anti hGCMa antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Lung tissue using GCM1 antibody
Immunohistochemical staining of human Spleen tissue using GCM1 antibody
Western blot analysis of human 293T tissue using GCM1 antibody
Western blot analysis of human Placenta tissue using GCM1 antibody
Filter by Rating