GCLC Rabbit Polyclonal Antibody

• Catalog Number: orb582389
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GCLC
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73 kDa
• Target: GCLC
• UniProt ID: P48506
• Protein Sequence: Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
• NCBI: NP_001489
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GCL, GCS, GLCL, GLCLC
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Peptide is also present in an isoform of ~28 kDa.

GCLC antibody - N-terminal region (orb582389), Catalog Number: orb582389, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse heart lysate, 3: 40 ug mouse heart lysate, 4: 40 ug mouse heart lysate, 5: 40 ug mouse heart lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GCLC.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.