Cart summary

You have no items in your shopping cart.

GCLC Rabbit Polyclonal Antibody

Catalog Number: orb582389

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb582389
CategoryAntibodies
DescriptionRabbit polyclonal antibody to GCLC
TargetGCLC
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
Protein SequenceSynthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
UniProt IDP48506
MW73 kDa
Tested applicationsIHC, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesGCL, GCS, GLCL, GLCLC
NoteFor research use only
NCBINP_001489
GCLC Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Peptide is also present in an isoform of ~28 kDa.

GCLC Rabbit Polyclonal Antibody

GCLC antibody - N-terminal region (orb582389), Catalog Number: orb582389, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GCLC Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

GCLC Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

GCLC Rabbit Polyclonal Antibody

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse heart lysate, 3: 40 ug mouse heart lysate, 4: 40 ug mouse heart lysate, 5: 40 ug mouse heart lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GCLC.

GCLC Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

GCLC Rabbit Polyclonal Antibody

WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

GCLC Rabbit Polyclonal Antibody

WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

  • GCLC Rabbit Polyclonal Antibody [orb582390]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GCLC Rabbit Polyclonal Antibody [orb500689]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Zebrafish

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Anti-GCLC Antibody [orb213983]

    IF,  IH,  WB

    Human, Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl
  • GCLC Antibody (N-term) [orb1937850]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • GCLC Antibody [orb627277]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg