You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb580442 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to GATM |
| Target | GATM |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GATM |
| Protein Sequence | Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN |
| UniProt ID | P50440 |
| MW | 48 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | AT, AGAT, CCDS3, FRTS1 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_001473 |
| Expiration Date | 12 months from date of receipt. |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human liver (LI), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

Rabbit Anti-GATM antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GATM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. GATM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Feline, Human, Mouse, Porcine, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Canine, Feline, Human, Mouse, Porcine, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Canine, Feline, Human, Mouse, Porcine, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Canine, Feline, Human, Mouse, Porcine, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review