You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326463 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GATC |
Target | GATC |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE |
UniProt ID | O43716 |
MW | 14kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti 15E1.2 antibody, anti FLJ37000 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_789788 |
WB Suggested Anti-GATC Antibody, Titration: 1.0 ug/mL, Positive Control: THP-1 Whole Cell.
WB | |
Bovine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
Biotin |