You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573932 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GATA6 |
Target | GATA6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GATA6 |
Protein Sequence | Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
UniProt ID | Q92908 |
MW | 60kDa |
Tested applications | IF, IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ASD9, AVSD5, PACHD |
Note | For research use only |
NCBI | NP_005248 |
Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.
Rabbit Anti-GATA6 Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.
The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.
WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.
IF, WB | |
Bovine, Canine, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Gallus, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |