GATA6 Antibody

SKU: orb1538069

Description

GATA6 Antibody

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC, IHC-P (5 µg/ml), WB (0.2 - 1 µg/ml)
• Reactivity: Human
• Application Notes:
  Not recommended for: IF. Further information: Immunohistochemistry: This was validated for use in immunohistochemistry on a panel of 21 formalin-fixed, paraffin-embedded (FFPE) human tissues after heat induced antigen retrieval in pH 6.0 citrate buffer. After incubation with the primary antibody, slides were incubated with biotinylated secondary antibody, followed by alkaline phosphatase-streptavidin and chromogen. The stained slides were evaluated by a pathologist to confirm staining specificity. The optimal working concentration was determined to be 5 ug/ml. Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1:50000 - 100000 as second antibody. ELISA titer in peptide based assay: 1:312500.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Synthetic peptide within the region SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS of human GATA6(Q92908, NP_005248).
• Target: GATA6
• Purification: Immunogen affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 0.09% sodium azide, 2% sucrose
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GATA6, GATA-binding factor 6, GATA-binding protein 6, GATA binding protein 6, Transcription factor GATA-6

Quick Database Links

Gene Symbol

GATA6