Cart summary

You have no items in your shopping cart.

GAPVD1 Rabbit Polyclonal Antibody (HRP)

GAPVD1 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2122166

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122166
CategoryAntibodies
DescriptionGAPVD1 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GAPVD1
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW166kDa
UniProt IDQ14C86
Protein SequenceSynthetic peptide located within the following region: FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ
NCBINP_056450
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesRAP6, GAPEX5, GAPex-5
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.