GAPVD1 Rabbit Polyclonal Antibody

• Catalog Number: orb325014
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GAPVD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAPVD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 166kDa
• Target: GAPVD1
• UniProt ID: Q14C86
• Protein Sequence: Synthetic peptide located within the following region: FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ
• NCBI: NP_056450
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZP434C212 antibody, anti KIAA1521 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Brain

WB Suggested Anti-GAPVD1 Antibody Titration: 0.25 ug/mL, Positive Control: HepG2 cell lysate.