GADD45B Rabbit Polyclonal Antibody

• Catalog Number: orb580375
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GADD45B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GADD45B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: GADD45B
• UniProt ID: O75293
• Protein Sequence: Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
• NCBI: NP_056490
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MYD118, GADD45BETA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

Sample Type: Fetal Lung lysates, Antibody dilution: 3.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.

Sample Type: Human Prostate Cancer, Primary Antibody dilution: 2 ug/ml, Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue), Gene Name: GADD45B.

WB Suggested Anti-GADD45B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.