You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GABRR2 |
| Target | GABRR2 |
| Protein Sequence | Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY |
| Molecular Weight | 54kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−GABRR2 Rabbit Polyclonal Antibody [orb666738]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μlGABRR2 Rabbit Polyclonal Antibody [orb514037]
ELISA, IHC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μgGABRR2 Rabbit Polyclonal Antibody (Biotin) [orb2133962]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-GABRR2 Antibody, Catalog Number: orb575363, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane(tight junctions - intercalated disks), Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GABRR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
Documents Download
Request a Document
Protocol Information
GABRR2 Rabbit Polyclonal Antibody (orb575363)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

