GABRP antibody

• Catalog Number: orb327619
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GABRP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Canine, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51 kDa
• Target: GABRP
• UniProt ID: O00591
• Protein Sequence: Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
• NCBI: NP_055026
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti MGC126386 antibody, anti MGC126387 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human 293T Whole Cell tissue using GABRP antibody

Immunohistochemical staining of human Intestine tissue using GABRP antibody

Western blot analysis of human Jurkat Cell tissue using GABRP antibody

Western blot analysis of human Jurkat Whole Cell tissue using GABRP antibody