You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327619 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GABRP |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 51 kDa |
Target | GABRP |
UniProt ID | O00591 |
Protein Sequence | Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
NCBI | NP_055026 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti MGC126386 antibody, anti MGC126387 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/mL.
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/mL.
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL.
Positive control (+): Human esophagus (ES), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.
Human Intestine
WB | |
Canine, Equine, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |