Cart summary

You have no items in your shopping cart.

GABRG3 Rabbit Polyclonal Antibody (HRP)

GABRG3 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2080937

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2080937
CategoryAntibodies
DescriptionGABRG3 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Mouse
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GABRG3
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW54kDa
UniProt IDQ99928
Protein SequenceSynthetic peptide located within the following region: LHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRP
NCBINP_150092
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
NoteFor research use only
Expiration Date12 months from date of receipt.